- Recombinant Bovine Gap junction gamma-3 protein (GJC3)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1014356
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 30,265 Da
- E Coli or Yeast
- 1-275
- gap junction protein, gamma 3, 30.2kDa
- Gap junction gamma-3 protein (GJC3)
Sequence
MCGSFLRRVAAEESRHPTPVGRLLLPALLGLRLVLLAAGGTGVFGGGEEQSEFVCHTQQAGCKAVCYDAFHPLSPLRFWAFQVTLVAVPSALYMGFILYHVIWHWEASEKVKTEEETLSQGEKGGEASRAGSSRLLWAYVAQLGVRLALEGAALGGQYHLYGFRMPSSFVCRLEPCLGSTNCYLSRPSEKSIFLKTMFGVTGLCLLFTLLELVLLGLGRWWRIWRHKSPSSNYSPTSQSAKRCKAPTDNFPVVEIRERPGEAGERGSEVPLSARP